General Information

  • ID:  hor004577
  • Uniprot ID:  Q8T697(2-44)
  • Protein name:  Thymosin beta
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Thymosin beta family
  • Source:  animal
  • Expression:  Expressed in regenerating axons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  SDKHDKPDISEVTKFDKSKLKKTETHEKNPLPTKETIDQEKQG
  • Length:  43(2-44)
  • Propeptide:  MSDKHDKPDISEVTKFDKSKLKKTETHEKNPLPTKETIDQEKQG
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton. May be involved in the regulation of structural plasticity in the CNS.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8T697-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004577_AF2.pdbhor004577_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 572885 Formula: C215H354N60O75
Absent amino acids: ACMRWY Common amino acids: K
pI: 7.7 Basic residues: 12
Polar residues: 10 Hydrophobic residues: 6
Hydrophobicity: -182.33 Boman Index: -15560
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 43.02
Instability Index: 2003.72 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16924592
  • Title:  Identification and Characterization of Homologues of Vertebrate Beta-Thymosin in the Marine Mollusk Aplysia Californica